AibGenesis™ ViroAb™ Rabbit Anti-Human ACE2 Monoclonal Antibody (XS-0186)

example

Documents

  • Datasheet

  • MSDS

  • COA

    Certificate of Analysis Lookup

    To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

    Lot Number

  • Tech Support

Cat#: VRS-0224-YT742

AibGenesis™ ViroAb™ Rabbit Anti-Human ACE2 Monoclonal Antibody (XS-0186)

Made to Order Requirements

Unconjugated

0.05 mL

Your choose infomation:

 CLEAR

(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)

  • Product Overview
  • Product Properties
  • Packaging, Storage & Formulations
  • Applications

Product Overview

Target : ACE2
Specificity : ACE2
Clone : XS-0186
Host Species : Rabbit
Antibody Isotype : IgG
Species Reactivity : Human; Mouse; Rat

Product Properties

Immunogen : QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMN
Purity : >95% as determined by SDS-PAGE
Purification : Affinity chromatography purified
Concentration : Lot specific

Packaging, Storage & Formulations

Form : Liquid
Formulation : PBS (pH 7.3), 0.02% Sodium Azide, 50% glycerol
Preservative : 0.01% Sodium Azide
Storage : Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application : WB; IF
Application Notes : WB: 1:500-1:2000
IF:1:50-1:200
The optimal working dilutions should be determined by the end user.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


Inquiry Basket