Documents
Cat#: VRS-0224-YT742
AibGenesis™ ViroAb™ Rabbit Anti-Human ACE2 Monoclonal Antibody (XS-0186)

Made to Order Requirements
Your choose infomation:
CLEAR(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
- Product Overview
- Product Properties
- Packaging, Storage & Formulations
- Applications
Product Overview
| Target : | ACE2 |
| Specificity : | ACE2 |
| Clone : | XS-0186 |
| Host Species : | Rabbit |
| Antibody Isotype : | IgG |
| Species Reactivity : | Human; Mouse; Rat |
Product Properties
| Immunogen : | QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMN |
| Purity : | >95% as determined by SDS-PAGE |
| Purification : | Affinity chromatography purified |
| Concentration : | Lot specific |
Packaging, Storage & Formulations
| Form : | Liquid |
| Formulation : | PBS (pH 7.3), 0.02% Sodium Azide, 50% glycerol |
| Preservative : | 0.01% Sodium Azide |
| Storage : | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Applications
| Application : | WB; IF |
| Application Notes : | WB: 1:500-1:2000 IF:1:50-1:200 The optimal working dilutions should be determined by the end user. |
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.