
Documents
Cat#: VRS-0224-YT716
ViroAb™ Mouse Anti-Human ACE2 Monoclonal Antibody (XS-0151)
This Mouse Monoclonal antibody is specific for Human ACE2 protein. The antibody can be used for applications: WB, IHC. The antibody is for Hypertensive Disease, Severe Acute Respiratory Syndrome, Kidney Diseases, Cardiovascular Diseases research use only and is not approved for use in humans or in clinical diagnosis.
Made to Order Requirements
Your choose infomation:
CLEAR(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
- Product Overview
- Product Properties
- Packaging, Storage & Formulations
- Applications
Product Overview
Target : | ACE2 |
Specificity : | ACE2 |
Clone : | XS-0151 |
Host Species : | Mouse |
Antibody Isotype : | IgG1 |
Species Reactivity : | Human |
Product Properties
Immunogen : | MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED |
Epitope : | Binds to an epitope located within the peptide sequence NMNNAGDKWSAFLKE as determined by overlapping synthetic peptides |
Purity : | >95% as determined by SDS-PAGE |
Purification : | Protein A affinity chromatography |
Concentration : | 1.0 mg/mL (lot specific) |
Packaging, Storage & Formulations
Form : | Liquid |
Formulation : | PBS (pH 7.2), 40% glycerol, 0.02% Sodium Azide |
Preservative : | 0.02% Sodium Azide |
Storage : | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Applications
Application : | WB; IHC |
Application Notes : | WB: 1 µg/ml IHC: 1:20000 - 1:50000 The optimal working dilutions should be determined by the end user. |
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.