Documents
Cat#: VRS-0224-YT716
AibGenesis™ ViroAb™ Mouse Anti-Human ACE2 Monoclonal Antibody (XS-0151)

Made to Order Requirements
Your choose infomation:
CLEAR(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
- Product Overview
- Product Properties
- Packaging, Storage & Formulations
- Applications
Product Overview
| Target : | ACE2 |
| Specificity : | ACE2 |
| Clone : | XS-0151 |
| Host Species : | Mouse |
| Antibody Isotype : | IgG1 |
| Species Reactivity : | Human |
Product Properties
| Immunogen : | MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED |
| Epitope : | Binds to an epitope located within the peptide sequence NMNNAGDKWSAFLKE as determined by overlapping synthetic peptides |
| Purity : | >95% as determined by SDS-PAGE |
| Purification : | Protein A affinity chromatography |
| Concentration : | 1.0 mg/mL (lot specific) |
Packaging, Storage & Formulations
| Form : | Liquid |
| Formulation : | PBS (pH 7.2), 40% glycerol, 0.02% Sodium Azide |
| Preservative : | 0.02% Sodium Azide |
| Storage : | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Applications
| Application : | WB; IHC |
| Application Notes : | WB: 1 µg/ml IHC: 1:20000 - 1:50000 The optimal working dilutions should be determined by the end user. |
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.