ViroAb™ Mouse Anti-Human ACE2 Monoclonal Antibody (XS-0151)

example

Documents

  • Datasheet

  • MSDS

  • COA

    Certificate of Analysis Lookup

    To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

    Lot Number

  • Tech Support

Cat#: VRS-0224-YT716

ViroAb™ Mouse Anti-Human ACE2 Monoclonal Antibody (XS-0151)

This Mouse Monoclonal antibody is specific for Human ACE2 protein. The antibody can be used for applications: WB, IHC. The antibody is for Hypertensive Disease, Severe Acute Respiratory Syndrome, Kidney Diseases, Cardiovascular Diseases research use only and is not approved for use in humans or in clinical diagnosis.

Made to Order Requirements

Unconjugated

0.1 mL

Your choose infomation:

 CLEAR

(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)

  • Product Overview
  • Product Properties
  • Packaging, Storage & Formulations
  • Applications

Product Overview

Target : ACE2
Specificity : ACE2
Clone : XS-0151
Host Species : Mouse
Antibody Isotype : IgG1
Species Reactivity : Human

Product Properties

Immunogen : MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Epitope : Binds to an epitope located within the peptide sequence NMNNAGDKWSAFLKE as determined by overlapping synthetic peptides
Purity : >95% as determined by SDS-PAGE
Purification : Protein A affinity chromatography
Concentration : 1.0 mg/mL (lot specific)

Packaging, Storage & Formulations

Form : Liquid
Formulation : PBS (pH 7.2), 40% glycerol, 0.02% Sodium Azide
Preservative : 0.02% Sodium Azide
Storage : Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application : WB; IHC
Application Notes : WB: 1 µg/ml
IHC: 1:20000 - 1:50000
The optimal working dilutions should be determined by the end user.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


Inquiry Basket