pepFastX™ Mouse Anti-EHV4 ORF74 (KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI) Monoclonal Antibody (03091YF)

example

Documents

  • Datasheet

  • MSDS

  • COA

    Certificate of Analysis Lookup

    To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

    Lot Number

  • Tech Support

Cat#: VRH-03091F

pepFastX™ Mouse Anti-EHV4 ORF74 (KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI) Monoclonal Antibody (03091YF)

This mouse monoclonal antibody 03091YF is generated from premade hybridoma library, and specific for Equid alphaherpesvirus 4 ORF74 (AA 169-199): KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI. For any additional requirments, please specify and submit an inquiry for assistance.

Made to Order Requirements

Unconjugated

APC

PE

FITC

HRP

Biotin

0.1 mg

0.2 mg

0.5 mg

1 mg

Your choose infomation:

 CLEAR

(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)

  • Antibody Testing Data
  • Product Overview
  • Product Properties
  • Applications

Product Overview

Target : ORF74
Specificity : EHV4
Clone : 03091YF
Host Species : Mouse
Antibody Isotype : IgG
Species Reactivity : Equid alphaherpesvirus 4

Product Properties

Immunogen : Synthetic peptide corresponding to amino acid sequence: KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI.
Epitope : KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI
Purity : >95%
Purification : Protein A or G affinity chromatography
Concentration : Lot specific

Applications

Application : ELISA
Application Notes : The antibody is screened by ELISA using the synthetic peptide that corresponds to amino acids sequence (KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI) as the capture antigen. Additional applications have not been validated. It is recommended that the end users validate other applications and determine optimal concentrations/dilution under their experimental conditions.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


Inquiry Basket