Documents
Cat#: VRH-03091F
pepFastX™ Mouse Anti-EHV4 ORF74 (KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI) Monoclonal Antibody (03091YF)
This mouse monoclonal antibody 03091YF is generated from premade hybridoma library, and specific for Equid alphaherpesvirus 4 ORF74 (AA 169-199): KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI. For any additional requirments, please specify and submit an inquiry for assistance.
Made to Order Requirements
Your choose infomation:
CLEAR(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
- Antibody Testing Data
- Product Overview
- Product Properties
- Applications
Product Overview
Target : | ORF74 |
Specificity : | EHV4 |
Clone : | 03091YF |
Host Species : | Mouse |
Antibody Isotype : | IgG |
Species Reactivity : | Equid alphaherpesvirus 4 |
Product Properties
Immunogen : | Synthetic peptide corresponding to amino acid sequence: KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI. |
Epitope : | KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI |
Purity : | >95% |
Purification : | Protein A or G affinity chromatography |
Concentration : | Lot specific |
Applications
Application : | ELISA |
Application Notes : | The antibody is screened by ELISA using the synthetic peptide that corresponds to amino acids sequence (KKPPTLPRVHVKTPPPILVPQVTPEAHTDFI) as the capture antigen. Additional applications have not been validated. It is recommended that the end users validate other applications and determine optimal concentrations/dilution under their experimental conditions. |
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.