Documents
Cat#: VRS-0224-YT1737
ViroAb™ Mouse Anti-ZIKV Env Monoclonal Antibody (XS-0095)
This Mouse Monoclonal antibody is specific for ZIKV Env protein. The antibody can be used for applications: IF, WB, IFA. The antibody is for Zika fever, Guillain-Barre syndrome, Microcephalydisease research use only and is not approved for use in humans or in clinical diagnosis.
Made to Order Requirements
Your choose infomation:
CLEAR(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
- Product Overview
- Product Properties
- Packaging, Storage & Formulations
- Applications
Product Overview
Target : | Env |
Specificity : | This antibody recognizes Zika virus E protein and is specific for the ED3 domain of ZIKV E protein. |
Clone : | XS-0095 |
Host Species : | Mouse |
Antibody Isotype : | IgG2b, kappa |
Species Reactivity : | Zika Virus |
Product Properties
Immunogen : | Bacterial expressed ED3 (dklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti) |
Epitope : | Zika ED3 |
Purity : | >95% as determined by SDS-PAGE |
Purification : | Protein G affinity chromatography |
Concentration : | Lot specific |
Packaging, Storage & Formulations
Form : | Liquid |
Formulation : | PBS |
Storage : | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Applications
Application : | IF; WB; IF |
Application Notes : | IF :1:2000 WB: 1µg/ml IFA: 0.1-10µg/ml The optimal working dilutions should be determined by the end user. |
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.