ViroAb™ Mouse Anti-ZIKV Env Monoclonal Antibody (XS-0095)

example

Documents

  • Datasheet

  • MSDS

  • COA

    Certificate of Analysis Lookup

    To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

    Lot Number

  • Tech Support

Cat#: VRS-0224-YT1737

ViroAb™ Mouse Anti-ZIKV Env Monoclonal Antibody (XS-0095)

This Mouse Monoclonal antibody is specific for ZIKV Env protein. The antibody can be used for applications: IF, WB, IFA. The antibody is for Zika fever, Guillain-Barre syndrome, Microcephalydisease research use only and is not approved for use in humans or in clinical diagnosis.

Made to Order Requirements

Unconjugated

0.1 mg

Your choose infomation:

 CLEAR

(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)

  • Product Overview
  • Product Properties
  • Packaging, Storage & Formulations
  • Applications

Product Overview

Target : Env
Specificity : This antibody recognizes Zika virus E protein and is specific for the ED3 domain of ZIKV E protein.
Clone : XS-0095
Host Species : Mouse
Antibody Isotype : IgG2b, kappa
Species Reactivity : Zika Virus

Product Properties

Immunogen : Bacterial expressed ED3 (dklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti)
Epitope : Zika ED3
Purity : >95% as determined by SDS-PAGE
Purification : Protein G affinity chromatography
Concentration : Lot specific

Packaging, Storage & Formulations

Form : Liquid
Formulation : PBS
Storage : Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application : IF; WB; IF
Application Notes : IF :1:2000
WB: 1µg/ml
IFA: 0.1-10µg/ml
The optimal working dilutions should be determined by the end user.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


Inquiry Basket