Documents
Cat#: VRS-0224-YT1737
AibGenesis™ ViroAb™ Mouse Anti-ZIKV Env Monoclonal Antibody (XS-0095)

Made to Order Requirements
Your choose infomation:
CLEAR(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
- Product Overview
- Product Properties
- Packaging, Storage & Formulations
- Applications
Product Overview
| Target : | Env |
| Specificity : | This antibody recognizes Zika virus E protein and is specific for the ED3 domain of ZIKV E protein. |
| Clone : | XS-0095 |
| Host Species : | Mouse |
| Antibody Isotype : | IgG2b, kappa |
| Species Reactivity : | Zika Virus |
Product Properties
| Immunogen : | Bacterial expressed ED3 (dklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti) |
| Epitope : | Zika ED3 |
| Purity : | >95% as determined by SDS-PAGE |
| Purification : | Protein G affinity chromatography |
| Concentration : | Lot specific |
Packaging, Storage & Formulations
| Form : | Liquid |
| Formulation : | PBS |
| Storage : | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Applications
| Application : | IF; WB; IF |
| Application Notes : | IF :1:2000 WB: 1µg/ml IFA: 0.1-10µg/ml The optimal working dilutions should be determined by the end user. |
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.