Search 'HA' Result - Creative BioLabs ViroAntibody

Book a Meeting

Home
Results found for 'HA'

Inquiry

Results found for 'HA'

Filtered By :Virus Species: influenza virus×

- Mouse Anti-Influenza virus HA Tag Monoclonal Antibody (XX0073) [Alexa Fluor® 488] (CAT#: VRX-0197X)
  - Host Species: Mouse
  - Isotype: IgG1
  - Application: WB
  - Species Reactivity: Tag
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (AGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKS) Monoclonal Antibody (06129YF) (CAT#: VRH-06129F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (ENQHTIDLTDSEMNKLFEKTRKQLRENAEDMGNGCF) Monoclonal Antibody (06133YF) (CAT#: VRH-06133F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (KGVELKSGYKDWILWISFAISCFLLCVVLLGFIM) Monoclonal Antibody (06137YF) (CAT#: VRH-06137F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H1N1 subtype HA (NIPSIQSRGLFGAIAGFIE) Monoclonal Antibody (06124YF) (CAT#: VRH-06124F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (ATGMRNVPEKQTRGIFGAIAGFIENGWEGMVD) Monoclonal Antibody (06130YF) (CAT#: VRH-06130F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (GRIQDLEKYVEDTKIDLWS) Monoclonal Antibody (06134YF) (CAT#: VRH-06134F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (KIDLWSYNAELLVALENQHTI) Monoclonal Antibody (06138YF) (CAT#: VRH-06138F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype HA (NVPEKQTRGIFGAIAGFIE) Monoclonal Antibody (06127YF) (CAT#: VRH-06127F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (EFSEVEGRIQDLEKYV) Monoclonal Antibody (06131YF) (CAT#: VRH-06131F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (HQIEKEFSEVEGRIQD) Monoclonal Antibody (06135YF) (CAT#: VRH-06135F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (LIEKTNEKFHQIEKEF) Monoclonal Antibody (06139YF) (CAT#: VRH-06139F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Anti-HA Recombinant Antibody Fab Fragment (VR0221) (CAT#: VRV-0495R)
  - Host Species: Human
  - Isotype: IgG
  - Application: Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody Fab Fragment (VR0237) (CAT#: VRV-0511R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: ELISA, IHC, FC, IP, IF, FuncS
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody (VR0235) (CAT#: VRV-0235R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: ELISA, IHC, FC, IP, IF, Block
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody (VR0239) (CAT#: VRV-0239R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: FC, IP, ELISA, Neut, FuncS, IF, ICC
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody Fab Fragment (VR0235) (CAT#: VRV-0509R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: ELISA, IHC, FC, IP, IF, Block
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody Fab Fragment (VR0239) (CAT#: VRV-0513R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: FC, IP, ELISA, Neut, FuncS, IF, ICC
  - Species Reactivity: Influenza Virus
- Anti-HA Recombinant Antibody (VR0221) (CAT#: VRV-0221R)
  - Host Species: Human
  - Isotype: IgG
  - Application: Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody (VR0237) (CAT#: VRV-0237R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: ELISA, IHC, FC, IP, IF, FuncS
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody Fab Fragment (VR0232) (CAT#: VRV-0506R)
  - Host Species: Human
  - Isotype: IgG
  - Application: Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody Fab Fragment (VR0238) (CAT#: VRV-0512R)
  - Host Species: Human
  - Isotype: IgG
  - Application: IP
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-HA Recombinant Antibody (VR0220) (CAT#: VRV-0220R)
  - Host Species: Human
  - Isotype: IgG1, lambda
  - Application: ELISA, Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody (VR0236) (CAT#: VRV-0236R)
  - Host Species: Mouse
  - Isotype: IgG2b, kappa
  - Application: ELISA, FC, Neut
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody (VR0240) (CAT#: VRV-0240R)
  - Host Species: Human
  - Isotype: IgG1, lambda
  - Application: Neut, ELISA, IF, IP, FuncS, FC, IHC
  - Species Reactivity: Influenza Virus
- Made to order
  Mouse Anti-H3N2 subtype HA (PRYVKQNTLKLATG) Monoclonal Antibody (06128YF) (CAT#: VRH-06128F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (EGRIQDLEKYVEDTKI) Monoclonal Antibody (06132YF) (CAT#: VRH-06132F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (IGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKD) Monoclonal Antibody (06136YF) (CAT#: VRH-06136F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (LIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKI) Monoclonal Antibody (06140YF) (CAT#: VRH-06140F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- NeutAb HiAb
  Anti-HA Recombinant Antibody Fab Fragment (VR0220) (CAT#: VRV-0494R)
  - Host Species: Human
  - Isotype: IgG1, lambda
  - Application: ELISA, Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody Fab Fragment (VR0236) (CAT#: VRV-0510R)
  - Host Species: Mouse
  - Isotype: IgG2b, kappa
  - Application: ELISA, FC, Neut
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody Fab Fragment (VR0240) (CAT#: VRV-0514R)
  - Host Species: Human
  - Isotype: IgG1, lambda
  - Application: Neut, ELISA, IF, IP, FuncS, FC, IHC
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody (VR0232) (CAT#: VRV-0232R)
  - Host Species: Human
  - Isotype: IgG
  - Application: Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody (VR0238) (CAT#: VRV-0238R)
  - Host Species: Human
  - Isotype: IgG
  - Application: IP
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody scFv Fragment (VR0232) (CAT#: VRV-0780R)
  - Host Species: Human
  - Isotype: IgG
  - Application: Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody scFv Fragment (VR0238) (CAT#: VRV-0786R)
  - Host Species: Human
  - Isotype: IgG
  - Application: IP
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody scFv Fragment (VR0235) (CAT#: VRV-0783R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: ELISA, IHC, FC, IP, IF, Block
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody scFv Fragment (VR0239) (CAT#: VRV-0787R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: FC, IP, ELISA, Neut, FuncS, IF, ICC
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-HA Recombinant Antibody scFv Fragment (VR0220) (CAT#: VRV-0768R)
  - Host Species: Human
  - Isotype: IgG1, lambda
  - Application: ELISA, Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody scFv Fragment (VR0236) (CAT#: VRV-0784R)
  - Host Species: Mouse
  - Isotype: IgG2b, kappa
  - Application: ELISA, FC, Neut
  - Species Reactivity: Influenza Virus
- NeutAb HiAb
  Anti-Influenza Virus HA Recombinant Antibody scFv Fragment (VR0240) (CAT#: VRV-0788R)
  - Host Species: Human
  - Isotype: IgG1, lambda
  - Application: Neut, ELISA, IF, IP, FuncS, FC, IHC
  - Species Reactivity: Influenza Virus
- Anti-HA Recombinant Antibody scFv Fragment (VR0221) (CAT#: VRV-0769R)
  - Host Species: Human
  - Isotype: IgG
  - Application: Neut, FuncS
  - Species Reactivity: Influenza Virus
- Anti-Influenza Virus HA Recombinant Antibody scFv Fragment (VR0237) (CAT#: VRV-0785R)
  - Host Species: Human
  - Isotype: IgG1, kappa
  - Application: ELISA, IHC, FC, IP, IF, FuncS
  - Species Reactivity: Influenza Virus
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (LLCVVLLGFIMWACQKGNIRCNICI) Monoclonal Antibody (06141YF) (CAT#: VRH-06141F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (QDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDS) Monoclonal Antibody (06145YF) (CAT#: VRH-06145F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (YVEDTKIDLWSYNAEL) Monoclonal Antibody (06149YF) (CAT#: VRH-06149F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H7N9 subtype HA (YAEMKWLLSNTDNAAFPQ) Monoclonal Antibody (06153YF) (CAT#: VRH-06153F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (LLVALENQHTIDLTDS) Monoclonal Antibody (06142YF) (CAT#: VRH-06142F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H3N2 subtype FLUAV (A/Hong Kong(H3N2)) HA (RENAEDMGNGCFKIYHKCDNACIGSIRNGTYDH) Monoclonal Antibody (06146YF) (CAT#: VRH-06146F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP
- Made to order
  Mouse Anti-H7N9 subtype HA (DKLYERVKRQLRENAEED) Monoclonal Antibody (06150YF) (CAT#: VRH-06150F)
  - Host Species: Mouse
  - Isotype: IgG
  - Species Reactivity: Influenza virus
  - Application: WB, ELISA, IHC-P, FC, ICC, IF, IP

Can't find the products you're looking for? Optimize our parameters for better results. Filter By Tag