Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Creative Biolabs has been setting the standard in quality virology research reagents for over 10 years.
This mouse monoclonal antibody 16513YF is generated from premade hybridoma library, and specific for SARS coronavirus S (AA 1128-1159): DSFKEELDKYFKNHTSPDVDLGDISGINASVV. For any additional requirments, please specify and submit an inquiry for assistance.
(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
Product Summary | |
---|---|
Product Category | Primary antibody |
Target | S |
Host | Mouse |
Specificity | SARS-CoV |
Isotype | IgG |
Clonality | Monoclonal |
Clone | 16513YF |
Immunogen | Synthetic peptide corresponding to amino acid sequence: DSFKEELDKYFKNHTSPDVDLGDISGINASVV. |
Conjugation | Unconjugated |
Purification | Purified with Protein A or G affinity chromatography |
Antigen Details | |
---|---|
Antigen | S |
Virus Species | Severe acute respiratory syndrome-related coronavirus |
Virus Family | Coronaviridae |
UniProt ID | P59594 |
Alternative Names | Spike glycoprotein, Severe acute respiratory syndrome-related coronavirus, SARS-CoV, S |
Packaging, Storage & Formulations | |
---|---|
Purity | >95% as determined by SDS |
Buffer | PBS (pH 7.4), please specify if any other requirements and can be lot specific. |
Form | Liquid, please specify if lyophilized powder is requried. |
Formulation | PBS (pH 7.4) without any preservative, please specify if any additional requirements. |
Preservative | Preservative-free, please specify if any additional requirements. |
Storage | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Application Notes | |
---|---|
Application | WB, ELISA, IHC-P, FC, ICC, IF, IP |
Application Notes | The optimal concentrations/dilutions should be determined by the end user. |
Copyright © 2023 Creative Biolabs. All Rights Reserved.