Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Mouse Anti-SARS-CoV-2 S Monoclonal Antibody (XX0412) (CAT#: VRX-1953X)
This Mouse Monoclonal antibody is specific for S protein. The antibody can be used for applications: Neut, ELISA. The antibody is for research use only and is not approved for use in humans or clinical diagnosis.
Specific Inquiry
(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
| Product Summary | |
|---|---|
| Product Category | Primary Antibody |
| Target | S |
| Host | Mouse |
| Species Reactivity | SARS-CoV-2 |
| Clonality | Monoclonal |
| Application | Neut, ELISA |
| Product Details | |
|---|---|
| Specificity | This antibody reacts with S of SARS-CoV-2. |
| Clone | XX0412 |
| Immunogen | SARS-CoV-2 |
| Isotype | IgG1 |
| Conjugation | Unconjugated |
| Antigen Details | |
|---|---|
| Full Name | Spike glycoprotein |
| Introduction | The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. It's been reported that 2019-nCoV can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor. The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity. The main functions for the Spike protein are summarized as: Mediate receptor binding and membrane fusion; Defines the range of the hosts and specificity of the virus; Main component to bind with the neutralizing antibody; Key target for vaccine design; Can be transmitted between different hosts through gene recombination or mutation of the receptor binding domain (RBD), leading to a higher mortality rate. |
| Gene ID | 43740568 |
| UniProt ID | P0DTC2 |
| Alternative Names | S, S glycoprotein, Spike, Spike glycoprotein, E2 glycoprotein precursor, SARS-CoV-2, SARS-CoV-2 S, SARS-CoV-2 Spike, 2019-nCoV, 2019-nCoV S, 2019-nCoV Spike |
| Related Disease | COVID-19 |
| Virus Details | |
|---|---|
| Virus Family | Coronaviridae |
| Virus Species | SARS-CoV-2 |
| Virus Classification | Positive-sense RNA Virus |
| Packaging, Storage & Formulations | |
|---|---|
| Storage | This antibody should be stored at -20°C. Avoid freeze/thaw cycles. |
| Buffer | PBS |
| Form | Liquid |
| Concentration | 1.0 mg/mL |
| Purity | > 95 % as determined by SDS-PAGE and SEC-HPLC. |
| Application Notes | |
|---|---|
| Application | Neut, ELISA |
| Application Notes | ELISA: 1:1000-1:2000 The optimal working dilutions should be determined by the end user. |
All products and services are intended for Research Use Only, and NOT to be used in diagnostic or therapeutic procedures.
Related products
- Mouse Anti-SARS-CoV Tor2 S (AFSLDVSEK) Monoclonal Antibody (17146YF) (CAT#: VRH-17146F)
- Mouse Anti-SARS-CoV Tor2 S (CGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFG) Monoclonal Antibody (16981YF) (CAT#: VRH-16981F)
- Mouse Anti-SARS-CoV S (KQLSSNFGAISSVLN) Monoclonal Antibody (16452YF) (CAT#: VRH-16452F)
- Mouse Anti-SARS-CoV BJ01 S (ALNTLVKQL) Monoclonal Antibody (16874YF) (CAT#: VRH-16874F)
- Mouse Anti-MERS-CoV Spike Monoclonal Antibody (XS-0234), IgM, Kappa (CAT#: VRX-0403S)
- Anti-SARS-CoV S Recombinant Antibody (VF0061) (CAT#: VRV-0061F)
- Mouse Anti-HBV subtype ayw S (LQAGFFLL) Monoclonal Antibody (06849YF) (CAT#: VRH-06849F)
- Mouse Anti-HBV subtype adw2 S (WLSAIWMMWYWGPS) Monoclonal Antibody (06685YF) (CAT#: VRH-06685F)
Application
3D IHC3D Immunohistochemistry
ActivActivation Assay
AgonistAgonist
ALPHAAmplified Luminescent Proximity Homogeneous Assay
AntagonistAntagonist
ADCCAntibody-dependent Cellular Cytotoxicity Assay
ApopApoptosis Assay
BABioAssay
BIBioimaging
BlockBlocking
CACell-based Assay/Cellular Assay
ChIPChromatin Immunoprecipitation
CMCDComplement Mediated Cell Depletion
CDCComplement-dependent Cytotoxicity Assay
CostimCostimulation Assay
CytCytotoxicity Assay
DepDepletion Assay
DBDot Blot/Slot blot
ECLElectrochemiluminescence
EMElectron Microscopy
EMSAElectrophoretic Mobility Shift Assay
ELISAEnzyme-Linked Immunosorbent Assay
ELISpotEnzyme-linked Immunosorbent Spot
FCFlow Cytometry
FIAFluorescence Immunoassay
FRETFluorescence Resonance Energy Transfer Microscopy
FuncSFunctional Assay
GSGel Super Shift Assay
HAHemagglutination Assay
IAImmunoassay
IBImmunoblotting
ICCImmunocytochemistry
IDImmunodiffusion
IEPImmunoelectrophoresis
IFImmunofluorescence
IHCImmunohistochemistry
IHC-FrImmunohistochemistry-Frozen
IHC-PImmunohistochemistry-Paraffin
REImmunohistology-Resin Sections
IMImmunomicroscopy
IPImmunoprecipitation
IRMAImmunoradiometric Assay
ISHIn Situ Hybridization
InhibInhibition Assay
ICFCIntracellular Staining for Flow Cytometry
Live-cell imagingLive-cell Imaging Assay
CyTOFMass Cytometry
MeDIPMethylated DNA Immunoprecipitation
MAMicroagglutination Assay
NeutNeutralization Assay
PAPeptide Array
PPProtein Purification
PGProteogenomics
RIRadial Immunodiffusion
RIARadioimmunoassay
StimStimulation Assay
SPRSurface Plasmon Resonance
TCAT-Cell Activation Assay
TRFTime-Resolved Fluorescence
TCTissue Culture
TBTurbidimetry
WBWestern Blot
HIHemagglutinin Inhibition
FLISAFluorescence-linked immunosorbent assay
CtrlControl
Dual ISH-IHCDual In Situ Hybridization-Immunohistochemistry
ICFCIntracellular Staining for Flow Cytometry
KDKnockdown Validated
BLIBio-Layer Interferometry
LFIALateral-Flow Immunochromatographic Assay
CryCrystallization
LFALateral flow assay
