Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Mouse Anti-HBV subtype adw2 S (GNSMFPS) Monoclonal Antibody (06446YF) (CAT#: VRH-06446F)
This mouse monoclonal antibody 06446YF is generated from premade hybridoma library, and specific for Hepatitis B virus subtype adw2 S (AA 304-310): GNSMFPS. For any additional requirments, please specify and submit an inquiry for assistance.
Specific Inquiry
(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
| Product Summary | |
|---|---|
| Product Category | Primary antibody |
| Target | S |
| Host | Mouse |
| Specificity | HBV subtype adw2 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Clone | 06446YF |
| Immunogen | Synthetic peptide corresponding to amino acid sequence: GNSMFPS. |
| Conjugation | Unconjugated |
| Purification | Purified with Protein A or G affinity chromatography |
| Antigen Details | |
|---|---|
| Antigen | S |
| Virus Species | Hepatitis B virus |
| Virus Family | Hepadnaviridae |
| UniProt ID | P03141 |
| Alternative Names | Large envelope protein, Hepatitis B virus, HBV subtype adw2, S |
| Packaging, Storage & Formulations | |
|---|---|
| Purity | >95% as determined by SDS |
| Buffer | PBS (pH 7.4), please specify if any other requirements and can be lot specific. |
| Form | Liquid, please specify if lyophilized powder is requried. |
| Formulation | PBS (pH 7.4) without any preservative, please specify if any additional requirements. |
| Preservative | Preservative-free, please specify if any additional requirements. |
| Storage | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
| Application Notes | |
|---|---|
| Application | WB, ELISA, IHC-P, FC, ICC, IF, IP |
| Application Notes | The optimal concentrations/dilutions should be determined by the end user. |
All products and services are intended for Research Use Only, and NOT to be used in diagnostic or therapeutic procedures.
Related products
- Mouse Anti-SARS-CoV S (DSFKEELDKYFKNHTSPDVDLGDISGINASVV) Monoclonal Antibody (16513YF) (CAT#: VRH-16513F)
- Mouse Anti-HCoV-229E S (LITGRLAAL) Monoclonal Antibody (06946YF) (CAT#: VRH-06946F)
- Mouse Anti-HBV subtype adw2 S (IPSSWAF) Monoclonal Antibody (06473YF) (CAT#: VRH-06473F)
- Anti-MERS-COV S Recombinant Antibody (VR0260) (CAT#: VRV-0260R)
- Mouse Anti-SARS-CoV Tor2 S (ITNFRAILTAFSPAQ) Monoclonal Antibody (17231YF) (CAT#: VRH-17231F)
- Mouse Anti-SARS-CoV S (LCCMTSCCSCLKGAC) Monoclonal Antibody (16456YF) (CAT#: VRH-16456F)
- Mouse Anti-SARS-CoV S (TDVSTAIHADQLTPAWRIYSTG) Monoclonal Antibody (16652YF) (CAT#: VRH-16652F)
- Mouse Anti-HBV S (TVNPVPTTASP) Monoclonal Antibody (06251YF) (CAT#: VRH-06251F)
Application
3D IHC3D Immunohistochemistry
ActivActivation Assay
AgonistAgonist
ALPHAAmplified Luminescent Proximity Homogeneous Assay
AntagonistAntagonist
ADCCAntibody-dependent Cellular Cytotoxicity Assay
ApopApoptosis Assay
BABioAssay
BIBioimaging
BlockBlocking
CACell-based Assay/Cellular Assay
ChIPChromatin Immunoprecipitation
CMCDComplement Mediated Cell Depletion
CDCComplement-dependent Cytotoxicity Assay
CostimCostimulation Assay
CytCytotoxicity Assay
DepDepletion Assay
DBDot Blot/Slot blot
ECLElectrochemiluminescence
EMElectron Microscopy
EMSAElectrophoretic Mobility Shift Assay
ELISAEnzyme-Linked Immunosorbent Assay
ELISpotEnzyme-linked Immunosorbent Spot
FCFlow Cytometry
FIAFluorescence Immunoassay
FRETFluorescence Resonance Energy Transfer Microscopy
FuncSFunctional Assay
GSGel Super Shift Assay
HAHemagglutination Assay
IAImmunoassay
IBImmunoblotting
ICCImmunocytochemistry
IDImmunodiffusion
IEPImmunoelectrophoresis
IFImmunofluorescence
IHCImmunohistochemistry
IHC-FrImmunohistochemistry-Frozen
IHC-PImmunohistochemistry-Paraffin
REImmunohistology-Resin Sections
IMImmunomicroscopy
IPImmunoprecipitation
IRMAImmunoradiometric Assay
ISHIn Situ Hybridization
InhibInhibition Assay
ICFCIntracellular Staining for Flow Cytometry
Live-cell imagingLive-cell Imaging Assay
CyTOFMass Cytometry
MeDIPMethylated DNA Immunoprecipitation
MAMicroagglutination Assay
NeutNeutralization Assay
PAPeptide Array
PPProtein Purification
PGProteogenomics
RIRadial Immunodiffusion
RIARadioimmunoassay
StimStimulation Assay
SPRSurface Plasmon Resonance
TCAT-Cell Activation Assay
TRFTime-Resolved Fluorescence
TCTissue Culture
TBTurbidimetry
WBWestern Blot
HIHemagglutinin Inhibition
FLISAFluorescence-linked immunosorbent assay
CtrlControl
Dual ISH-IHCDual In Situ Hybridization-Immunohistochemistry
ICFCIntracellular Staining for Flow Cytometry
KDKnockdown Validated
BLIBio-Layer Interferometry
LFIALateral-Flow Immunochromatographic Assay
CryCrystallization
LFALateral flow assay
