Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Human Anti-MERS-CoV Spike Monoclonal Antibody (XS-0234), IgM, Kappa (CAT#: VRX-0399S)
This Human Monoclonal antibody is specific for MERS-CoV Spike protein. The antibody can be used for applications: Block,Neut. The antibody is for Middle East Respiratory Syndromedisease research use only and is not approved for use in humans or in clinical diagnosis.
Specific Inquiry
(Note: Please select the requirements to fit you project. If you have any other requirements, please specify. If no specific requirements, you don't need to select any button.)
| Product Summary | |
|---|---|
| Product Category | Primary Antibody |
| Target | S |
| Host | Human |
| Species Reactivity | MERS-CoV |
| Clonality | Monoclonal |
| Application | Block, Neut |
| Product Details | |
|---|---|
| Specificity | This antibody specifcally binds the amino acids 349-590 in the S1 domain of the MERS-CoV. |
| Clone | XS-0234 |
| Immunogen | The original antibody was generated by isolating neutralizing antibodies from a non-immune human Ab-phage library using a novel panning strategy. |
| Isotype | IgM, Kappa |
| Conjugation | Unconjugated |
| Antigen Details | |
|---|---|
| Full Name | Spike glycoprotein |
| Introduction | The MERS-CoV spike (S) protein is a type I transmembrane glycoprotein which contains 1353 amino acids and can be cleaved into two subunit S1 and S2. It forms large protruding spikes on the surface of the virus. The S1 subunit which contains RBD is responsible for binding to Dipeptidyl peptidase 4, which serves as the host cell receptor of MERS-CoV and S2 mediates the membrane fusion. In this process, heptad repeats 1 and 2 (HR1 and HR2) of the S protein assemble into a complex called six-helix bundle (6-HB) fusion core structure, which represents a key membrane fusion architecture. Importantly, the S protein is considered a key component of vaccines against coronavirus infection, including severe acute respiratory syndrome (SARS). |
| Gene ID | 14254594 |
| UniProt ID | W6A028 |
| Alternative Names | MERS Spike gylcoprotein, MERS S glycoprotein, MERS E2, MERS Peplomer protein, MERS Spike protein S2, MERS-RBD, Middle East respiratory syndrome coronavirus spike |
| Related Disease | Middle East Respiratory Syndrome |
| Virus Details | |
|---|---|
| Virus Family | Coronaviridae |
| Virus Species | MERS-COV |
| Virus Classification | Positive-sense RNA Virus |
| Packaging, Storage & Formulations | |
|---|---|
| Purification | Affinity Purified using a recombinant lectin column |
| Storage | Store at 4°C for short term. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
| Buffer | PBS |
| Form | Liquid |
| Preservative | 0.02% Proclin 300. |
| Formulation | PBS with 0.02% Proclin 300. |
| Concentration | 1 mg/mL |
| Purity | >95% as determined by SDS-PAGE |
| Application Notes | |
|---|---|
| Application | Block, Neut |
| Application Notes | This antibody blocks the binding of MERS-CoV spike protein to DPP4 receptor by binding to the aa 349-590 in the S1 domain of the MERS-CoV.The optimal working dilutions should be determined by the end user. |
All products and services are intended for Research Use Only, and NOT to be used in diagnostic or therapeutic procedures.
Related products
- Mouse Anti-SARS-CoV S (LDKVEAEVQIDRLIT) Monoclonal Antibody (16457YF) (CAT#: VRH-16457F)
- Anti-SARS-CoV S Recombinant Antibody (VF0016) (CAT#: VRV-0016F)
- Mouse Anti-SARS-CoV S (FFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSF) Monoclonal Antibody (16419YF) (CAT#: VRH-16419F)
- Mouse Anti-HBV subtype adw2 S (QWFVGLSPTVWLSA) Monoclonal Antibody (06603YF) (CAT#: VRH-06603F)
- Mouse Anti-SARS-CoV S (NNTVYDPLQPELDSF) Monoclonal Antibody (16469YF) (CAT#: VRH-16469F)
- Mouse Anti-HBV subtype adw2 S (WEWASVR) Monoclonal Antibody (06679YF) (CAT#: VRH-06679F)
- Mouse Anti-SARS-CoV S (KLPDDFMGC) Monoclonal Antibody (16553YF) (CAT#: VRH-16553F)
- Mouse Anti-HBV S (DWDFNPNKDTWPDAN) Monoclonal Antibody (06200YF) (CAT#: VRH-06200F)
Application
3D IHC3D Immunohistochemistry
ActivActivation Assay
AgonistAgonist
ALPHAAmplified Luminescent Proximity Homogeneous Assay
AntagonistAntagonist
ADCCAntibody-dependent Cellular Cytotoxicity Assay
ApopApoptosis Assay
BABioAssay
BIBioimaging
BlockBlocking
CACell-based Assay/Cellular Assay
ChIPChromatin Immunoprecipitation
CMCDComplement Mediated Cell Depletion
CDCComplement-dependent Cytotoxicity Assay
CostimCostimulation Assay
CytCytotoxicity Assay
DepDepletion Assay
DBDot Blot/Slot blot
ECLElectrochemiluminescence
EMElectron Microscopy
EMSAElectrophoretic Mobility Shift Assay
ELISAEnzyme-Linked Immunosorbent Assay
ELISpotEnzyme-linked Immunosorbent Spot
FCFlow Cytometry
FIAFluorescence Immunoassay
FRETFluorescence Resonance Energy Transfer Microscopy
FuncSFunctional Assay
GSGel Super Shift Assay
HAHemagglutination Assay
IAImmunoassay
IBImmunoblotting
ICCImmunocytochemistry
IDImmunodiffusion
IEPImmunoelectrophoresis
IFImmunofluorescence
IHCImmunohistochemistry
IHC-FrImmunohistochemistry-Frozen
IHC-PImmunohistochemistry-Paraffin
REImmunohistology-Resin Sections
IMImmunomicroscopy
IPImmunoprecipitation
IRMAImmunoradiometric Assay
ISHIn Situ Hybridization
InhibInhibition Assay
ICFCIntracellular Staining for Flow Cytometry
Live-cell imagingLive-cell Imaging Assay
CyTOFMass Cytometry
MeDIPMethylated DNA Immunoprecipitation
MAMicroagglutination Assay
NeutNeutralization Assay
PAPeptide Array
PPProtein Purification
PGProteogenomics
RIRadial Immunodiffusion
RIARadioimmunoassay
StimStimulation Assay
SPRSurface Plasmon Resonance
TCAT-Cell Activation Assay
TRFTime-Resolved Fluorescence
TCTissue Culture
TBTurbidimetry
WBWestern Blot
HIHemagglutinin Inhibition
FLISAFluorescence-linked immunosorbent assay
CtrlControl
Dual ISH-IHCDual In Situ Hybridization-Immunohistochemistry
ICFCIntracellular Staining for Flow Cytometry
KDKnockdown Validated
BLIBio-Layer Interferometry
LFIALateral-Flow Immunochromatographic Assay
CryCrystallization
LFALateral flow assay
